PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 324aa    MW: 36142.2 Da    PI: 5.504
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629125.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.63e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +v+++G+g+W++++ + g++R+ k+c++rw +yl
   XP_009629125.1 14 KGPWTPEEDIMLVSYVQEHGPGNWRAVPTKTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.61.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_009629125.1  67 RGSFTDQEEKMIIQLQALLGNK-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.873965IPR017930Myb domain
SuperFamilySSF466895.87E-3111108IPR009057Homeodomain-like
SMARTSM007175.6E-151363IPR001005SANT/Myb domain
PfamPF002496.2E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241568IPR009057Homeodomain-like
CDDcd001673.24E-111661No hitNo description
PROSITE profilePS5129420.01866116IPR017930Myb domain
SMARTSM007178.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2569117IPR009057Homeodomain-like
CDDcd001676.09E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIMLVSYVQ EHGPGNWRAV PTKTGLRRCS KSCRLRWTNY  60
LRPGIKRGSF TDQEEKMIIQ LQALLGNKWA AIASYLPERT DNDIKNYWNT HLKKKMKNLQ  120
EKCSGDDDLF SVENGHNFSS SNSTSRGQWE RTLQTDINMA KKALHNALSL ENSTPYIKQE  180
TPAKVSTYAS STENIARLLQ GWMRSSSSTN NSENSKTSSN NIAATTDSSS CDGTPSAESK  240
GGVGIMEAFE SLFGLETFES SSSDQLSQTA SPEASKFQVE IKKEENNSQV PLSVMLENWL  300
FDENTIQGKD DLTIFSFDET ADPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-261411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-261411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-271411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX991341e-150X99134.1 L.esculentum mRNA for myb-related transcription factor, THM6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629125.10.0PREDICTED: myb-related protein 306-like
RefseqXP_016432585.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-104MYB06_ANTMA; Myb-related protein 306
TrEMBLK4B7661e-163K4B766_SOLLC; Uncharacterized protein
TrEMBLQ401751e-163Q40175_SOLLC; Transcription factor
STRINGSolyc02g067340.2.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-103myb domain protein 94